Lineage for d2b8aa1 (2b8a A:1-110)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784737Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1784826Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 1784832Protein Hepatoma-derived growth factor, HDGF [117151] (2 species)
  7. 1784835Species Norway rat (Rattus norvegicus) [TaxId:10116] [141211] (1 PDB entry)
    Uniprot Q8VHK7 1-110
  8. 1784836Domain d2b8aa1: 2b8a A:1-110 [128067]

Details for d2b8aa1

PDB Entry: 2b8a (more details)

PDB Description: high resolution structure of the hdgf pwwp domain
PDB Compounds: (A:) Hepatoma-derived growth factor

SCOPe Domain Sequences for d2b8aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8aa1 b.34.9.2 (A:1-110) Hepatoma-derived growth factor, HDGF {Norway rat (Rattus norvegicus) [TaxId: 10116]}
msrsnrqkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgp
kdlfpyeeskekfgkpnkrkgfseglweiennptvkasgyqssqkkscae

SCOPe Domain Coordinates for d2b8aa1:

Click to download the PDB-style file with coordinates for d2b8aa1.
(The format of our PDB-style files is described here.)

Timeline for d2b8aa1: