![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
![]() | Family b.34.9.2: PWWP domain [69250] (6 proteins) includes the C-terminal all-alpha subdomain |
![]() | Protein Hepatoma-derived growth factor, HDGF [117151] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [141211] (2 PDB entries) Uniprot Q8VHK7 1-110 |
![]() | Domain d2b8aa1: 2b8a A:1-110 [128067] |
PDB Entry: 2b8a (more details)
SCOPe Domain Sequences for d2b8aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b8aa1 b.34.9.2 (A:1-110) Hepatoma-derived growth factor, HDGF {Norway rat (Rattus norvegicus) [TaxId: 10116]} msrsnrqkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgp kdlfpyeeskekfgkpnkrkgfseglweiennptvkasgyqssqkkscae
Timeline for d2b8aa1: