Lineage for d2b45x_ (2b45 X:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780100Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2780123Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries)
  8. 2780150Domain d2b45x_: 2b45 X: [162991]
    automated match to d1bvva_
    complexed with epe

Details for d2b45x_

PDB Entry: 2b45 (more details), 2 Å

PDB Description: crystal structure of an engineered uninhibited bacillus subtilis xylanase in free state
PDB Compounds: (X:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d2b45x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b45x_ b.29.1.11 (X:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtfgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
ddttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOPe Domain Coordinates for d2b45x_:

Click to download the PDB-style file with coordinates for d2b45x_.
(The format of our PDB-style files is described here.)

Timeline for d2b45x_: