Lineage for d2ax3a2 (2ax3 A:1-211)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1882948Fold c.104: YjeF N-terminal domain-like [64152] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 32145678; strand 8 is antiparallel to the rest
  4. 1882949Superfamily c.104.1: YjeF N-terminal domain-like [64153] (2 families) (S)
    possible circular permutation of the ribokinase-like fold (of the YjeF C-terminal domain)
  5. 1882950Family c.104.1.1: YjeF N-terminal domain-like [64154] (2 proteins)
  6. 1882951Protein Hypothetical protein TM0922, N-terminal domain [142716] (1 species)
    YjeF homolog
  7. 1882952Species Thermotoga maritima [TaxId:2336] [142717] (21 PDB entries)
    Uniprot Q9X024 1-211
  8. 1882968Domain d2ax3a2: 2ax3 A:1-211 [127478]
    Other proteins in same PDB: d2ax3a1
    complex with unidentified peptide, chain B
    complexed with gol

Details for d2ax3a2

PDB Entry: 2ax3 (more details), 2.27 Å

PDB Description: crystal structure of a putative carbohydrate kinase (tm0922) from thermotoga maritima msb8 at 2.25 a resolution
PDB Compounds: (A:) hypothetical protein TM0922

SCOPe Domain Sequences for d2ax3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ax3a2 c.104.1.1 (A:1-211) Hypothetical protein TM0922, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mkeideltikeygvdsrilmeragisvvlameeelgnlsdyrflvlcgggnnggdgfvva
rnllgvvkdvlvvflgkkktpdceynyglykkfggkvveqfepsilnefdvvvdaifgtg
lrgeitgeyaeiinlvnksgkvvvsvdvpsgidsntgkvlrtavkadltvtfgvpkighi
lfpgrdltgklkvanighpvhlinsinryvi

SCOPe Domain Coordinates for d2ax3a2:

Click to download the PDB-style file with coordinates for d2ax3a2.
(The format of our PDB-style files is described here.)

Timeline for d2ax3a2:

1882968
d2ax3a2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2ax3a1