![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.104: YjeF N-terminal domain-like [64152] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 32145678; strand 8 is antiparallel to the rest |
![]() | Superfamily c.104.1: YjeF N-terminal domain-like [64153] (2 families) ![]() possible circular permutation of the ribokinase-like fold (of the YjeF C-terminal domain) |
![]() | Family c.104.1.1: YjeF N-terminal domain-like [64154] (2 proteins) |
![]() | Protein Hypothetical protein TM0922, N-terminal domain [142716] (1 species) YjeF homolog |
![]() | Species Thermotoga maritima [TaxId:2336] [142717] (21 PDB entries) Uniprot Q9X024 1-211 |
![]() | Domain d2ax3a2: 2ax3 A:1-211 [127478] Other proteins in same PDB: d2ax3a1, d2ax3a3 complex with unidentified peptide, chain B complexed with gol |
PDB Entry: 2ax3 (more details), 2.27 Å
SCOPe Domain Sequences for d2ax3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ax3a2 c.104.1.1 (A:1-211) Hypothetical protein TM0922, N-terminal domain {Thermotoga maritima [TaxId: 2336]} mkeideltikeygvdsrilmeragisvvlameeelgnlsdyrflvlcgggnnggdgfvva rnllgvvkdvlvvflgkkktpdceynyglykkfggkvveqfepsilnefdvvvdaifgtg lrgeitgeyaeiinlvnksgkvvvsvdvpsgidsntgkvlrtavkadltvtfgvpkighi lfpgrdltgklkvanighpvhlinsinryvi
Timeline for d2ax3a2: