SCOPe 2.08: Domain d2ax3a2: 2ax3 A:1-211

Lineage for d2ax3a2 (2ax3 A:1-211)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.104: YjeF N-terminal domain-like [64152] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 32145678; strand 8 is antiparallel to the rest

4. Superfamily c.104.1: YjeF N-terminal domain-like [64153] (2 families)
   possible circular permutation of the ribokinase-like fold (of the YjeF C-terminal domain)

5. Family c.104.1.1: YjeF N-terminal domain-like [64154] (2 proteins)

6. Protein Hypothetical protein TM0922, N-terminal domain [142716] (1 species)
   YjeF homolog

7. Species Thermotoga maritima [TaxId:2336] [142717] (21 PDB entries)
   Uniprot Q9X024 1-211

8. Domain d2ax3a2: 2ax3 A:1-211 [127478]
   Other proteins in same PDB: d2ax3a1, d2ax3a3
   complex with unidentified peptide, chain B
   complexed with gol

Details for d2ax3a2

PDB Entry: 2ax3, 2.27 Å

PDB Description: crystal structure of a putative carbohydrate kinase (tm0922) from thermotoga maritima msb8 at 2.25 a resolution

PDB Compounds: (A:) hypothetical protein TM0922

SCOPe Domain Sequences for d2ax3a2:

Sequence; same for both SEQRES and ATOM records:

>d2ax3a2 c.104.1.1 (A:1-211) Hypothetical protein TM0922, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mkeideltikeygvdsrilmeragisvvlameeelgnlsdyrflvlcgggnnggdgfvva
rnllgvvkdvlvvflgkkktpdceynyglykkfggkvveqfepsilnefdvvvdaifgtg
lrgeitgeyaeiinlvnksgkvvvsvdvpsgidsntgkvlrtavkadltvtfgvpkighi
lfpgrdltgklkvanighpvhlinsinryvi

Timeline for d2ax3a2:

• d2ax3a2 first appeared in SCOP 1.73
  
• d2ax3a2 appears in SCOPe 2.07