Lineage for d2aq2a1 (2aq2 A:1-117)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023718Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2023862Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries)
  8. 2023863Domain d2aq2a1: 2aq2 A:1-117 [144824]
    Other proteins in same PDB: d2aq2b1, d2aq2b2
    complexed with na, so4, zn; mutant

Details for d2aq2a1

PDB Entry: 2aq2 (more details), 1.8 Å

PDB Description: crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
PDB Compounds: (A:) T-cell receptor beta chain V

SCOPe Domain Sequences for d2aq2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
eaavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdi
pdgyeasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl

SCOPe Domain Coordinates for d2aq2a1:

Click to download the PDB-style file with coordinates for d2aq2a1.
(The format of our PDB-style files is described here.)

Timeline for d2aq2a1: