| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.10: ROK [110636] (8 proteins) Pfam PF00480 |
| Protein Putative regulator protein YcfX [142475] (1 species) |
| Species Salmonella typhimurium [TaxId:90371] [142476] (1 PDB entry) Uniprot Q8ZPZ9 1-117! Uniprot Q8ZPZ9 118-303 |
| Domain d2ap1a1: 2ap1 A:118-303 [127108] Other proteins in same PDB: d2ap1a3 complexed with na, zn |
PDB Entry: 2ap1 (more details), 1.9 Å
SCOPe Domain Sequences for d2ap1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ap1a1 c.55.1.10 (A:118-303) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]}
eftqyplvmglilgtgvggglvlngkpitgqsyitgefghmrlpvdaltlmgfdfplrrc
gcgqmgcienylsgrgfawlyqhyydqslqapeiialweqgdeqahahveryldllavcl
gniltivdpdllviggglsnftaittqlaerlprhllpvaraprierarhgdaggmrgaa
flhltd
Timeline for d2ap1a1: