Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Guanylate kinase [52542] (5 species) |
Species Escherichia coli [TaxId:562] [102338] (6 PDB entries) |
Domain d2anba_: 2anb A: [127039] automated match to d1s96a_ complexed with 5gp, so4 |
PDB Entry: 2anb (more details), 2.9 Å
SCOPe Domain Sequences for d2anba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2anba_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt iiraerlrmsrqkqrhdaliskllad
Timeline for d2anba_: