Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins) contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2) |
Protein DNA polymerase iota [111295] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [111296] (19 PDB entries) Uniprot Q9UNA4 |
Domain d2alza2: 2alz A:25-299 [126995] Other proteins in same PDB: d2alza1 protein/DNA complex; complexed with dcp, mg |
PDB Entry: 2alz (more details), 2.5 Å
SCOPe Domain Sequences for d2alza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2alza2 e.8.1.7 (A:25-299) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]} assrvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyearklgvkklmnvrda kekcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlq sdelsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnkl laklvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtf spkilekelgisvaqriqklsfgednspvilsgpp
Timeline for d2alza2: