Lineage for d2al6a3 (2al6 A:31-130)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1195253Family d.15.1.4: First domain of FERM [54256] (6 proteins)
  6. 1195263Protein Focal adhesion kinase 1 [142960] (1 species)
  7. 1195264Species Chicken (Gallus gallus) [TaxId:9031] [142961] (3 PDB entries)
    Uniprot Q00944 31-130
  8. 1195265Domain d2al6a3: 2al6 A:31-130 [126968]
    Other proteins in same PDB: d2al6a1, d2al6a2, d2al6b1, d2al6b2
    binds linker segment 394-403 as an extra beta-strand

Details for d2al6a3

PDB Entry: 2al6 (more details), 2.35 Å

PDB Description: FERM domain of Focal Adhesion Kinase
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2al6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2al6a3 d.15.1.4 (A:31-130) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
gamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshl
qseevhwlhldmgvsnvrekfelahppeewkyelrirylp

SCOPe Domain Coordinates for d2al6a3:

Click to download the PDB-style file with coordinates for d2al6a3.
(The format of our PDB-style files is described here.)

Timeline for d2al6a3: