Lineage for d2aema2 (2aem A:245-338)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like foldSuperfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) 
Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
Pfam PF02080Protein Potassium channel-related protein MthK, C-terminal domain [116728] (1 species) Species Methanothermobacter thermautotrophicus [TaxId:145262] [116729] (5 PDB entries) 
Domain d2aema2: 2aem A:245-338 [230509]
Other proteins in same PDB: d2aema1
automated match to d2fy8a2
Details for d2aema2
PDB Entry: 2aem (more details), 2.8 Å
PDB Description: Crystal Structures of the MthK RCK Domain
PDB Compounds: (A:) Calcium-gated potassium channel mthKSCOPe Domain Sequences for d2aema2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aema2 d.286.1.1 (A:245-338) Potassium channel-related protein MthK, C-terminal domain {Methanothermobacter thermautotrophicus [TaxId: 145262]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisalv
SCOPe Domain Coordinates for d2aema2:
Click to download the PDB-style file with coordinates for d2aema2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aema2:
- d2aema2 first appeared in SCOPe 2.03
- d2aema2 appears in SCOPe 2.04
- d2aema2 appears in SCOPe 2.06
- d2aema2 appears in the current release, SCOPe 2.08
View in 3D
