Lineage for d2ab1a1 (2ab1 A:2-122)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919238Fold c.103: MTH938-like [64075] (1 superfamily)
    core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest
  4. 2919239Superfamily c.103.1: MTH938-like [64076] (1 family) (S)
    automatically mapped to Pfam PF04430
  5. 2919240Family c.103.1.1: MTH938-like [64077] (5 proteins)
  6. 2919251Protein Hypothetical protein PTD015 (C11orf67) [142443] (1 species)
  7. 2919252Species Human (Homo sapiens) [TaxId:9606] [142444] (2 PDB entries)
    Uniprot Q9H7C9 2-122
  8. 2919255Domain d2ab1a1: 2ab1 A:2-122 [126503]
    Other proteins in same PDB: d2ab1a2, d2ab1b3

Details for d2ab1a1

PDB Entry: 2ab1 (more details), 2.59 Å

PDB Description: x-ray structure of gene product from homo sapiens hs.95870
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2ab1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ab1a1 c.103.1.1 (A:2-122) Hypothetical protein PTD015 (C11orf67) {Human (Homo sapiens) [TaxId: 9606]}
tspeiaslswgqmkvkgsnttykdckvwpggsrtwdwretgtehspgvqpadvkevvekg
vqtlvigrgmsealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhst
c

SCOPe Domain Coordinates for d2ab1a1:

Click to download the PDB-style file with coordinates for d2ab1a1.
(The format of our PDB-style files is described here.)

Timeline for d2ab1a1:

2919255
d2ab1a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2ab1a2