SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ab1b2 (2ab1 B:2-122)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148350Fold c.103: MTH938-like [64075] (1 superfamily)
    core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest
  4. 2148351Superfamily c.103.1: MTH938-like [64076] (1 family) (S)
    automatically mapped to Pfam PF04430
  5. 2148352Family c.103.1.1: MTH938-like [64077] (5 protein domains)
  6. 2148363Protein Hypothetical protein PTD015 (C11orf67) [142443] (1 species)
  7. 2148364Species Human (Homo sapiens) [TaxId:9606] [142444] (2 PDB entries)
    Uniprot Q9H7C9 2-122
  8. 2148368Domain d2ab1b2: 2ab1 B:2-122 [126504]
    Other proteins in same PDB: d2ab1a2, d2ab1b3
    automated match to d2ab1a1

Details for d2ab1b2

PDB Entry: 2ab1 (more details), 2.59 Å

PDB Description: X-Ray Structure of Gene Product from Homo Sapiens HS.95870
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2ab1b2:

Sequence, based on SEQRES records: (download)

>d2ab1b2 c.103.1.1 (B:2-122) Hypothetical protein PTD015 (C11orf67) {Human (Homo sapiens) [TaxId: 9606]}
tspeiaslswgqmkvkgsnttykdckvwpggsrtwdwretgtehspgvqpadvkevvekg
vqtlvigrgmsealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhst
c

Sequence, based on observed residues (ATOM records): (download)

>d2ab1b2 c.103.1.1 (B:2-122) Hypothetical protein PTD015 (C11orf67) {Human (Homo sapiens) [TaxId: 9606]}
tspeiaslswgqmkvkgsnttykdckvwpggsrtwdgvqpadvkevvekgvqtlvigrgm
sealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhstc

SCOPe Domain Coordinates for d2ab1b2:

Click to download the PDB-style file with coordinates for d2ab1b2.
(The format of our PDB-style files is described here.)

Timeline for d2ab1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ab1b3