![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.103: MTH938-like [64075] (1 superfamily) core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest |
![]() | Superfamily c.103.1: MTH938-like [64076] (1 family) ![]() automatically mapped to Pfam PF04430 |
![]() | Family c.103.1.1: MTH938-like [64077] (5 proteins) |
![]() | Protein Hypothetical protein PTD015 (C11orf67) [142443] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142444] (2 PDB entries) Uniprot Q9H7C9 2-122 |
![]() | Domain d2ab1b2: 2ab1 B:2-122 [126504] Other proteins in same PDB: d2ab1a2, d2ab1b3 automated match to d2ab1a1 |
PDB Entry: 2ab1 (more details), 2.59 Å
SCOPe Domain Sequences for d2ab1b2:
Sequence, based on SEQRES records: (download)
>d2ab1b2 c.103.1.1 (B:2-122) Hypothetical protein PTD015 (C11orf67) {Human (Homo sapiens) [TaxId: 9606]} tspeiaslswgqmkvkgsnttykdckvwpggsrtwdwretgtehspgvqpadvkevvekg vqtlvigrgmsealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhst c
>d2ab1b2 c.103.1.1 (B:2-122) Hypothetical protein PTD015 (C11orf67) {Human (Homo sapiens) [TaxId: 9606]} tspeiaslswgqmkvkgsnttykdckvwpggsrtwdgvqpadvkevvekgvqtlvigrgm sealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhstc
Timeline for d2ab1b2: