Lineage for d2ab0a1 (2ab0 A:2-196)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) 
conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structuresFamily c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
contains a catalytic triad or dyad different from the class I GAT triad
Protein Protein ThiJ (YajL) [142070] (1 species) Species Escherichia coli [TaxId:562] [142071] (1 PDB entry)
Uniprot Q46948 2-196
Domain d2ab0a1: 2ab0 A:2-196 [126501]
Other proteins in same PDB: d2ab0b_
Details for d2ab0a1
PDB Entry: 2ab0 (more details), 1.1 Å
PDB Description: Crystal Structure of E. coli protein YajL (ThiJ)
PDB Compounds: (A:) YajLSCOPe Domain Sequences for d2ab0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]}
sasalvclapgseeteavttidllvrggikvttasvasdgnlaitcsrgvklladaplve
vadgeydvivlpggikgaecfrdstllvetvkqfhrsgrivaaicaapatvlvphdifpi
gnmtgfptlkdkipaeqwldkrvvwdarvklltsqgpgtaidfglkiidllvgrekahev
asqlvmaagiynyye
SCOPe Domain Coordinates for d2ab0a1:
Click to download the PDB-style file with coordinates for d2ab0a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ab0a1:
- d2ab0a1 first appeared in SCOP 1.73
- d2ab0a1 appears in SCOPe 2.07
View in 3D
