Lineage for d2aaib1 (2aai B:1-135)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) 
Family b.42.2.1: Ricin B-like [50371] (11 proteins) 
Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
duplication: consists of two domains of this fold
Species Castor bean (Ricinus communis), Ricin [TaxId:3988] [50373] (3 PDB entries)
Uniprot P06750 303-564
Domain d2aaib1: 2aai B:1-135 [25561]
Other proteins in same PDB: d2aaia_
Details for d2aaib1
PDB Entry: 2aai (more details), 2.5 Å
PDB Description: crystallographic refinement of ricin to 2.5 angstroms
PDB Compounds: (B:) ricin (b chain)SCOPe Domain Sequences for d2aaib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aaib1 b.42.2.1 (B:1-135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]}
advcmdpepivrivgrnglcvdvrdgrfhngnaiqlwpcksntdanqlwtlkrdntirsn
gkclttygyspgvyvmiydcntaatdatrwqiwdngtiinprsslvlaatsgnsgttltv
qtniyavsqgwlptn
SCOPe Domain Coordinates for d2aaib1:
Click to download the PDB-style file with coordinates for d2aaib1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aaib1:
- d2aaib1 first appeared (with stable ids) in SCOP 1.55
- d2aaib1 appears in SCOPe 2.04
- d2aaib1 appears in SCOPe 2.06
- d2aaib1 appears in the current release, SCOPe 2.08
View in 3D
