Class b: All beta proteins [48724] (176 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein Plant cytotoxin B-chain (lectin) [50372] (5 species) duplication: consists of two domains of this fold |
Species Castor bean (Ricinus communis), Ricin [TaxId:3988] [50373] (3 PDB entries) Uniprot P06750 303-564 |
Domain d2aaib2: 2aai B:136-262 [25562] Other proteins in same PDB: d2aaia_ |
PDB Entry: 2aai (more details), 2.5 Å
SCOPe Domain Sequences for d2aaib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} ntqpfvttivglyglclqansgqvwiedcssekaeqqwalyadgsirpqqnrdncltsds niretvvkilscgpassgqrwmfkndgtilnlysglvldvrasdpslkqiilyplhgdpn qiwlplf
Timeline for d2aaib2: