Lineage for d2a5la1 (2a5l A:3-198)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families) 
Family c.23.5.8: WrbA-like [117474] (3 proteins) 
Protein Trp repressor binding protein WrbA [117475] (4 species) 
Species Pseudomonas aeruginosa [TaxId:287] [142053] (3 PDB entries)
Uniprot Q9I509 3-198! Uniprot Q9I509 4-196
Domain d2a5la1: 2a5l A:3-198 [126176]
Other proteins in same PDB: d2a5lb_
complexed with mg
Details for d2a5la1
PDB Entry: 2a5l (more details), 1.7 Å
PDB Description: The crystal structure of the Trp repressor binding protein WrbA from Pseudomonas aeruginosa
PDB Compounds: (A:) Trp repressor binding protein WrbASCOPe Domain Sequences for d2a5la1:
Sequence, based on SEQRES records: (download)
>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]}
spyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaegalya
tledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggq
ettqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlc
ralgkrlaetagklgs
Sequence, based on observed residues (ATOM records): (download)
>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]}
spyilvlyysrhgataemarqiargveqggfearvrtvpavstalyatledlkncaglal
gsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpllh
hgmlvlgipytpygashfagadgkrsldeheltlcralgkrlaetagklgs
SCOPe Domain Coordinates for d2a5la1:
Click to download the PDB-style file with coordinates for d2a5la1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2a5la1:
- d2a5la1 first appeared in SCOP 1.73
- d2a5la1 appears in SCOPe 2.06
- d2a5la1 appears in the current release, SCOPe 2.08
View in 3D
