Lineage for d2a4ca_ (2a4c A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.6: Cadherin-like [49313] (3 families) 
Family b.1.6.0: automated matches [191376] (1 protein)
not a true familyProtein automated matches [190458] (4 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [187373] (6 PDB entries) 
Domain d2a4ca_: 2a4c A: [162672]
automated match to d1o6sb_
Details for d2a4ca_
PDB Entry: 2a4c (more details), 2.9 Å
PDB Description: Crystal structure of mouse cadherin-11 EC1
PDB Compounds: (A:) Cadherin-11SCOPe Domain Sequences for d2a4ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a4ca_ b.1.6.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sgwvwnqffvieeytgpdpvlvgrlhsdidsgdgnikyilsgegagtifviddksgniha
tktldreeraqytlmaqavdrdtnrpleppsefivkvqd
SCOPe Domain Coordinates for d2a4ca_:
Click to download the PDB-style file with coordinates for d2a4ca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2a4ca_:
- d2a4ca_ first appeared in SCOPe 2.01
- d2a4ca_ appears in SCOPe 2.04
- d2a4ca_ is called d2a4ca1 in SCOPe 2.06
- d2a4ca_ appears in the current release, SCOPe 2.08, called d2a4ca1
View in 3D
