PDB entry 2a4c

View 2a4c on RCSB PDB site
Description: Crystal structure of mouse cadherin-11 EC1
Class: cell adhesion
Keywords: Cadherin, Extracellular domain, Dimer, CELL ADHESION
Deposited on 2005-06-28, released 2006-04-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.204
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cadherin-11
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh11, Cad-11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55288 (1-98)
      • cloning artifact (0)
    Domains in SCOPe 2.05: d2a4ca_
  • Chain 'B':
    Compound: Cadherin-11
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh11, Cad-11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55288 (1-98)
      • cloning artifact (0)
    Domains in SCOPe 2.05: d2a4cb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2a4cA (A:)
sgwvwnqffvieeytgpdpvlvgrlhsdidsgdgnikyilsgegagtifviddksgniha
tktldreeraqytlmaqavdrdtnrpleppsefivkvqd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2a4cB (B:)
sgwvwnqffvieeytgpdpvlvgrlhsdidsgdgnikyilsgegagtifviddksgniha
tktldreeraqytlmaqavdrdtnrpleppsefivkvqd