Lineage for d1zuja1 (1zuj A:6-173)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1264537Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1264697Species Lactococcus lactis, DpsA [TaxId:1358] [140434] (1 PDB entry)
    Uniprot A2RLG8 6-173
  8. 1264698Domain d1zuja1: 1zuj A:6-173 [125672]

Details for d1zuja1

PDB Entry: 1zuj (more details), 2.9 Å

PDB Description: The crystal structure of the Lactococcus lactis MG1363 DpsA protein
PDB Compounds: (A:) hypothetical protein Llacc01001955

SCOPe Domain Sequences for d1zuja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zuja1 a.25.1.1 (A:6-173) Dodecameric ferritin homolog {Lactococcus lactis, DpsA [TaxId: 1358]}
sidekyeaevkkseidhhkptagamlshvlsnifyekislmqaglyaksanyrikfreia
lkedewfyliseqlldenelvpttldefvsnhkfiendpkakywtdealienfindfqnq
nlfigraiklaqkeekfslelairklygynlsiipyfagelgktigef

SCOPe Domain Coordinates for d1zuja1:

Click to download the PDB-style file with coordinates for d1zuja1.
(The format of our PDB-style files is described here.)

Timeline for d1zuja1: