Lineage for d1zkib_ (1zki B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
core: beta-alpha-beta(4); 2 layers: alpha/betaSuperfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) 
Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) 
Protein Hypothetical protein PA5202 [143175] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [143176] (1 PDB entry)
Uniprot Q9HTY7 4-129
Domain d1zkib_: 1zki B: [125200]
automated match to d1zkia1
complexed with acy
Details for d1zkib_
PDB Entry: 1zki (more details), 1.7 Å
PDB Description: structure of conserved protein pa5202 from pseudomonas aeruginosa
PDB Compounds: (B:) hypothetical protein PA5202SCOPe Domain Sequences for d1zkib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zkib_ d.38.1.5 (B:) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]}
pareqmisayselvgldpvslgdgvaevrlpmaahlrnrggvmhggalfslmdvtmglac
ssshgfdrqsvtleckinyiravadgevrcvarvlhagrrslvveaevrqgdklvakgqg
tfaql
SCOPe Domain Coordinates for d1zkib_:
Click to download the PDB-style file with coordinates for d1zkib_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zkib_:
- d1zkib_ first appeared in SCOP 1.73, called d1zkib1
- d1zkib_ appears in SCOPe 2.04
- d1zkib_ appears in SCOPe 2.06
- d1zkib_ appears in the current release, SCOPe 2.08
View in 3D
