Lineage for d1zkib1 (1zki B:5-129)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721568Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins)
  6. 721602Protein Hypothetical protein PA5202 [143175] (1 species)
  7. 721603Species Pseudomonas aeruginosa [TaxId:287] [143176] (1 PDB entry)
  8. 721605Domain d1zkib1: 1zki B:5-129 [125200]
    automatically matched to 1ZKI A:4-129
    complexed with acy

Details for d1zkib1

PDB Entry: 1zki (more details), 1.7 Å

PDB Description: structure of conserved protein pa5202 from pseudomonas aeruginosa
PDB Compounds: (B:) hypothetical protein PA5202

SCOP Domain Sequences for d1zkib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkib1 d.38.1.5 (B:5-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]}
pareqmisayselvgldpvslgdgvaevrlpmaahlrnrggvmhggalfslmdvtmglac
ssshgfdrqsvtleckinyiravadgevrcvarvlhagrrslvveaevrqgdklvakgqg
tfaql

SCOP Domain Coordinates for d1zkib1:

Click to download the PDB-style file with coordinates for d1zkib1.
(The format of our PDB-style files is described here.)

Timeline for d1zkib1: