Lineage for d1zhra_ (1zhr A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1793669Protein Coagulation factor XI [117237] (1 species)
  7. 1793670Species Human (Homo sapiens) [TaxId:9606] [117238] (32 PDB entries)
    Uniprot P03951 388-624
  8. 1793672Domain d1zhra_: 1zhr A: [162481]
    automated match to d1xxda_
    complexed with ben; mutant

Details for d1zhra_

PDB Entry: 1zhr (more details), 1.73 Å

PDB Description: crystal structure of the catalytic domain of coagulation factor xi in complex with benzamidine (s434a-t475a-c482s-k437a mutant)
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d1zhra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zhra_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqaeiaedtsffgvqeiiihdqykmaesgydiallklettvnyadsqrpislpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOPe Domain Coordinates for d1zhra_:

Click to download the PDB-style file with coordinates for d1zhra_.
(The format of our PDB-style files is described here.)

Timeline for d1zhra_: