Lineage for d1zgka1 (1zgk A:322-609)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1134683Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1135244Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 1135245Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 1135246Protein Kelch-like ECH-associated protein 1, KEAP1 [117283] (2 species)
  7. 1135247Species Human (Homo sapiens) [TaxId:9606] [117284] (3 PDB entries)
    Uniprot Q14145 322-609
  8. 1135248Domain d1zgka1: 1zgk A:322-609 [145998]

Details for d1zgka1

PDB Entry: 1zgk (more details), 1.35 Å

PDB Description: 1.35 angstrom structure of the Kelch domain of Keap1
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d1zgka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]}
pkvgrliytaggyfrqslsyleaynpsngtwlrladlqvprsglagcvvggllyavggrn
nspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsve
ryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmit
amntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitv
hqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

SCOPe Domain Coordinates for d1zgka1:

Click to download the PDB-style file with coordinates for d1zgka1.
(The format of our PDB-style files is described here.)

Timeline for d1zgka1: