Lineage for d1z3qa_ (1z3q A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777878Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2777879Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2777880Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 2778007Protein automated matches [190195] (6 species)
    not a true protein
  7. 2778052Species Musa acuminata [TaxId:4641] [188166] (1 PDB entry)
  8. 2778053Domain d1z3qa_: 1z3q A: [162370]
    automated match to d1du5a_
    complexed with edo

Details for d1z3qa_

PDB Entry: 1z3q (more details), 1.7 Å

PDB Description: Resolution of the structure of the allergenic and antifungal banana fruit thaumatin-like protein at 1.7A
PDB Compounds: (A:) Thaumatin-like protein

SCOPe Domain Sequences for d1z3qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z3qa_ b.25.1.1 (A:) automated matches {Musa acuminata [TaxId: 4641]}
atfeivnrcsytvwaaavpgggrqlnqgqswtinvnagttggriwgrtgcsfdgsgrgrc
qtgdcggvlsctaygnppntlaefalnqfnnldffdislvdgfnvpmdfsptsggcrgir
caadingqcpgalkapggcnnpctvfktdqyccnsgacsptdysqffkrncpdaysypkd
dqtttftcpggtnyrvvfcp

SCOPe Domain Coordinates for d1z3qa_:

Click to download the PDB-style file with coordinates for d1z3qa_.
(The format of our PDB-style files is described here.)

Timeline for d1z3qa_: