PDB entry 1z3q

View 1z3q on RCSB PDB site
Description: Resolution of the structure of the allergenic and antifungal banana fruit thaumatin-like protein at 1.7A
Class: antifungal protein
Keywords: beta sandwich, ANTIFUNGAL PROTEIN
Deposited on 2005-03-14, released 2006-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.144
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thaumatin-like protein
    Species: Musa acuminata [TaxId:4641]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z3qa_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z3qA (A:)
    atfeivnrcsytvwaaavpgggrqlnqgqswtinvnagttggriwgrtgcsfdgsgrgrc
    qtgdcggvlsctaygnppntlaefalnqfnnldffdislvdgfnvpmdfsptsggcrgir
    caadingqcpgalkapggcnnpctvfktdqyccnsgacsptdysqffkrncpdaysypkd
    dqtttftcpggtnyrvvfcp