Lineage for d1yk3a1 (1yk3 A:10-207)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037211Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1037212Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1037213Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1037372Protein Hypothetical protein Rv1347c/MT1389 [143668] (1 species)
  7. 1037373Species Mycobacterium tuberculosis [TaxId:1773] [143669] (1 PDB entry)
    Uniprot P64819 10-207
  8. 1037374Domain d1yk3a1: 1yk3 A:10-207 [123493]
    complexed with bog

Details for d1yk3a1

PDB Entry: 1yk3 (more details), 2.2 Å

PDB Description: crystal structure of rv1347c from mycobacterium tuberculosis
PDB Compounds: (A:) Hypothetical protein Rv1347c/MT1389

SCOPe Domain Sequences for d1yk3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]}
addalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewmnrphlaaaw
eydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyydadpydlgl
haaiadlskvnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlcewagckflg
ehdttnrrmalyaleapt

SCOPe Domain Coordinates for d1yk3a1:

Click to download the PDB-style file with coordinates for d1yk3a1.
(The format of our PDB-style files is described here.)

Timeline for d1yk3a1: