SCOPe 2.06: Domain d1yifa2: 1yif A:2-324

Lineage for d1yifa2 (1yif A:2-324)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
consists of five 4-stranded beta-sheet motifs; meander
Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)
Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
automatically mapped to Pfam PF04616
Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)
Species Bacillus subtilis [TaxId:1423] [141540] (1 PDB entry)
Uniprot P94489 2-324
Domain d1yifa2: 1yif A:2-324 [123284]
Other proteins in same PDB: d1yifa1, d1yifb1, d1yifc1, d1yifd1

Details for d1yifa2

PDB Entry: 1yif (more details), 1.8 Å

PDB Description: crystal structure of beta-1,4-xylosidase from bacillus subtilis, new york structural genomics consortium

PDB Compounds: (A:) beta-1,4-xylosidase

SCOPe Domain Sequences for d1yifa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yifa2 b.67.2.1 (A:2-324) Beta-D-xylosidase N-terminal domain {Bacillus subtilis [TaxId: 1423]}
kitnpvlkgfnpdpsicragedyyiavstfewfpgvqihhskdlvnwhlvahplqrvsql
dmkgnpnsggvwapclsysdgkfwliytdvkvvdgawkdchnylvtcetingdwsepikl
nssgfdaslfhdtdgkkyllnmlwdhridrhsfggiviqeysdkeqkligkpkvifegtd
rklteaphlyhignyyylltaeggtryehaatiarsaniegpyevhpdnpiltswhdpgn
plqkcghasivqthtdewylahltgrpihpdddsifqqrgycplgretaiqklywkdewp
yvvggkegslevdapsipetife

SCOPe Domain Coordinates for d1yifa2:

Click to download the PDB-style file with coordinates for d1yifa2.
(The format of our PDB-style files is described here.)

Timeline for d1yifa2: