Lineage for d1yhna_ (1yhn A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein Rab7 [110540] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [142230] (2 PDB entries)
Uniprot P51149 7-182
Domain d1yhna_: 1yhn A: [123178]
Other proteins in same PDB: d1yhnb1
automated match to d1vg0b_
complexed with gtp, mg
Details for d1yhna_
PDB Entry: 1yhn (more details), 3 Å
PDB Description: structure basis of rilp recruitment by rab7
PDB Compounds: (A:) Ras-related protein Rab-7SCOPe Domain Sequences for d1yhna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yhna_ c.37.1.8 (A:) Rab7 {Human (Homo sapiens) [TaxId: 9606]}
srkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiw
dtaglerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvv
lgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevel
yne
SCOPe Domain Coordinates for d1yhna_:
Click to download the PDB-style file with coordinates for d1yhna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yhna_:
- d1yhna_ first appeared in SCOP 1.73, called d1yhna1
- d1yhna_ appears in SCOPe 2.05
- d1yhna_ appears in SCOPe 2.07
- d1yhna_ appears in the current release, SCOPe 2.08
View in 3D
