Lineage for d1yfua1 (1yfu A:1-174)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080855Family b.82.1.20: 3-hydroxyanthranilic acid dioxygenase-like [141618] (2 proteins)
    Pfam PF06052; 3-HAO
  6. 2080856Protein 3-hydroxyanthranilate-3,4-dioxygenase [141619] (2 species)
  7. 2080859Species Ralstonia metallidurans [TaxId:119219] [141620] (11 PDB entries)
    Uniprot Q1LCS4 1-174
  8. 2080861Domain d1yfua1: 1yfu A:1-174 [123094]
    complexed with cl, fe, trs

Details for d1yfua1

PDB Entry: 1yfu (more details), 1.9 Å

PDB Description: Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase from Ralstonia metallidurans
PDB Compounds: (A:) 3-hydroxyanthranilate-3,4-dioxygenase

SCOPe Domain Sequences for d1yfua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]}
mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa

SCOPe Domain Coordinates for d1yfua1:

Click to download the PDB-style file with coordinates for d1yfua1.
(The format of our PDB-style files is described here.)

Timeline for d1yfua1: