Lineage for d1ybza1 (1ybz A:2-75)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777702Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 777703Superfamily a.130.1: Chorismate mutase II [48600] (4 families) (S)
  5. 777704Family a.130.1.1: Dimeric chorismate mutase [48601] (3 proteins)
    intertwined homodimer of 3-helical subunits
  6. 777713Protein mono-domain chorismate mutase [140940] (1 species)
  7. 777714Species Pyrococcus furiosus [TaxId:2261] [140941] (1 PDB entry)
    Uniprot Q8U098 2-75
  8. 777715Domain d1ybza1: 1ybz A:2-75 [122901]
    complexed with unx

Details for d1ybza1

PDB Entry: 1ybz (more details), 1.82 Å

PDB Description: conserved hypothetical protein from pyrococcus furiosus pfu-1581948- 001
PDB Compounds: (A:) chorismate mutase

SCOP Domain Sequences for d1ybza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybza1 a.130.1.1 (A:2-75) mono-domain chorismate mutase {Pyrococcus furiosus [TaxId: 2261]}
ttlkllrkeidkidnqiisllkkrleiaqaigkikkelnlpiedrkreeevlrragefre
ifekilevskdvqr

SCOP Domain Coordinates for d1ybza1:

Click to download the PDB-style file with coordinates for d1ybza1.
(The format of our PDB-style files is described here.)

Timeline for d1ybza1: