Lineage for d1ybza1 (1ybz A:2-75)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011335Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2011336Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2011337Family a.130.1.1: Dimeric chorismate mutase [48601] (4 protein domains)
    intertwined homodimer of 3-helical subunits
  6. 2011346Protein mono-domain chorismate mutase [140940] (1 species)
  7. 2011347Species Pyrococcus furiosus [TaxId:2261] [140941] (1 PDB entry)
    Uniprot Q8U098 2-75
  8. 2011348Domain d1ybza1: 1ybz A:2-75 [122901]
    Other proteins in same PDB: d1ybza2
    complexed with unx

Details for d1ybza1

PDB Entry: 1ybz (more details), 1.82 Å

PDB Description: Conserved hypothetical protein from Pyrococcus furiosus Pfu-1581948-001
PDB Compounds: (A:) chorismate mutase

SCOPe Domain Sequences for d1ybza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybza1 a.130.1.1 (A:2-75) mono-domain chorismate mutase {Pyrococcus furiosus [TaxId: 2261]}
ttlkllrkeidkidnqiisllkkrleiaqaigkikkelnlpiedrkreeevlrragefre
ifekilevskdvqr

SCOPe Domain Coordinates for d1ybza1:

Click to download the PDB-style file with coordinates for d1ybza1.
(The format of our PDB-style files is described here.)

Timeline for d1ybza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ybza2