![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
![]() | Superfamily a.130.1: Chorismate mutase II [48600] (5 families) ![]() |
![]() | Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins) intertwined homodimer of 3-helical subunits |
![]() | Protein mono-domain chorismate mutase [140940] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [140941] (1 PDB entry) Uniprot Q8U098 2-75 |
![]() | Domain d1ybza1: 1ybz A:2-75 [122901] Other proteins in same PDB: d1ybza2 complexed with unx |
PDB Entry: 1ybz (more details), 1.82 Å
SCOPe Domain Sequences for d1ybza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ybza1 a.130.1.1 (A:2-75) mono-domain chorismate mutase {Pyrococcus furiosus [TaxId: 2261]} ttlkllrkeidkidnqiisllkkrleiaqaigkikkelnlpiedrkreeevlrragefre ifekilevskdvqr
Timeline for d1ybza1: