Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
Protein Calcineurin (FKBP12.6) [54539] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54542] (1 PDB entry) |
Domain d1yata_: 1yat A: [38427] complexed with fk5 |
PDB Entry: 1yat (more details), 2.5 Å
SCOPe Domain Sequences for d1yata_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} seviegnvkidrispgdgatfpktgdlvtihytgtlengqkfdssvdrgspfqcnigvgq vikgwdvgipklsvgekarltipgpyaygprgfpglippnstlvfdvellkvn
Timeline for d1yata_: