Lineage for d1y97a1 (1y97 A:1-228)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1607175Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1607532Protein Three prime repair exonuclease 2, TREX2 [142499] (1 species)
  7. 1607533Species Human (Homo sapiens) [TaxId:9606] [142500] (1 PDB entry)
    Uniprot Q9BQ50 44-271
  8. 1607534Domain d1y97a1: 1y97 A:1-228 [122773]

Details for d1y97a1

PDB Entry: 1y97 (more details), 2.5 Å

PDB Description: The human TREX2 3' exonuclease structure suggests a mechanism for efficient non-processive DNA catalysis
PDB Compounds: (A:) Three prime repair exonuclease 2

SCOPe Domain Sequences for d1y97a1:

Sequence, based on SEQRES records: (download)

>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]}
mseapraetfvfldleatglpsvepeiaelslfavhrsslenpehdesgalvlprvldkl
tlcmcperpftakaseitglsseglarcrkagfdgavvrtlqaflsrqagpiclvahngf
dydfpllcaelrrlgarlprdtvcldtlpalrgldrahshgtrargrqgyslgslfhryf
raepsaahsaegdvhtllliflhraaellawadeqargwahiepmylp

Sequence, based on observed residues (ATOM records): (download)

>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]}
mseapraetfvfldleatglpsvepeiaelslfavhrsslenpehgalvlprvldkltlc
mcperpftakaseitglsseglarcrkagfdgavvrtlqaflsrqagpiclvahngfdyd
fpllcaelrrlgarlprdtvcldtlpalrgldrahgyslgslfhryfraepssaegdvht
llliflhraaellawadeqargwahiepmylp

SCOPe Domain Coordinates for d1y97a1:

Click to download the PDB-style file with coordinates for d1y97a1.
(The format of our PDB-style files is described here.)

Timeline for d1y97a1: