Lineage for d1y02a1 (1y02 A:71-114)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
helix-extended loop-helix; parallel helices
Superfamily a.140.2: SAP domain [68906] (1 family) 
Family a.140.2.1: SAP domain [68907] (7 proteins)
Pfam PF02037Protein Rififylin (FYVE-RING finger protein Sakura) [116766] (1 species) Species Human (Homo sapiens) [TaxId:9606] [116767] (1 PDB entry)
Uniprot Q8WZ73 45-139
Domain d1y02a1: 1y02 A:71-114 [116278]
Other proteins in same PDB: d1y02a2
complexed with zn
Details for d1y02a1
PDB Entry: 1y02 (more details), 1.8 Å
PDB Description: Crystal Structure of a FYVE-type domain from caspase regulator CARP2
PDB Compounds: (A:) FYVE-RING finger protein SAKURASCOP Domain Sequences for d1y02a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y02a1 a.140.2.1 (A:71-114) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]}
fqreelmkmkvkdlrdylslhdistemcrekeelvllvlgqqpv
SCOP Domain Coordinates for d1y02a1:
Click to download the PDB-style file with coordinates for d1y02a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1y02a1:
- d1y02a1 first appeared in SCOP 1.71
- d1y02a1 appears in SCOP 1.73
- d1y02a1 appears in SCOPe 2.01
- d1y02a1 appears in the current release, SCOPe 2.08
View in 3D
