Lineage for d1y02a1 (1y02 A:71-114)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649863Fold a.140: LEM/SAP HeH motif [63450] (5 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 649877Superfamily a.140.2: SAP domain [68906] (1 family) (S)
  5. 649878Family a.140.2.1: SAP domain [68907] (7 proteins)
    Pfam PF02037
  6. 649896Protein Rififylin (FYVE-RING finger protein Sakura) [116766] (1 species)
  7. 649897Species Human (Homo sapiens) [TaxId:9606] [116767] (1 PDB entry)
  8. 649898Domain d1y02a1: 1y02 A:71-114 [116278]
    Other proteins in same PDB: d1y02a2
    complexed with zn

Details for d1y02a1

PDB Entry: 1y02 (more details), 1.8 Å

PDB Description: Crystal Structure of a FYVE-type domain from caspase regulator CARP2
PDB Compounds: (A:) FYVE-RING finger protein SAKURA

SCOP Domain Sequences for d1y02a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y02a1 a.140.2.1 (A:71-114) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]}
fqreelmkmkvkdlrdylslhdistemcrekeelvllvlgqqpv

SCOP Domain Coordinates for d1y02a1:

Click to download the PDB-style file with coordinates for d1y02a1.
(The format of our PDB-style files is described here.)

Timeline for d1y02a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y02a2