Class a: All alpha proteins [46456] (284 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.11: Alpha-hemoglobin stabilizing protein AHSP [109751] (1 family) the bundle twist angle is close to zero (small positive value); similar to the RRF alpha-helical bundle, (55194) |
Family a.7.11.1: Alpha-hemoglobin stabilizing protein AHSP [109752] (1 protein) this is a repeat family; one repeat unit is 1w0a A: found in domain |
Protein Alpha-hemoglobin stabilizing protein AHSP [109753] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [109754] (7 PDB entries) Uniprot Q9NZD4 1-94 |
Domain d1xzya_: 1xzy A: [116275] |
PDB Entry: 1xzy (more details)
SCOPe Domain Sequences for d1xzya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xzya_ a.7.11.1 (A:) Alpha-hemoglobin stabilizing protein AHSP {Human (Homo sapiens) [TaxId: 9606]} mallkankdlisaglkefsvllnqqvfndplvseedmvtvvedwmnfyinyyrqqvtgep qerdkalqelrqelntlanpflakyrdflk
Timeline for d1xzya_: