Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.8: RPF-like [159824] (2 proteins) Pfam PF06737; Transglycosylase-like domain |
Protein Probable resuscitation-promoting factor RpfB [159825] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [159826] (1 PDB entry) Uniprot O05594 247-362 |
Domain d1xsfa1: 1xsf A:23-108 [145890] |
PDB Entry: 1xsf (more details)
SCOPe Domain Sequences for d1xsfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsfa1 d.2.1.8 (A:23-108) Probable resuscitation-promoting factor RpfB {Mycobacterium tuberculosis [TaxId: 1773]} ppvidgsiwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeq iavaevtrlrqgwgawpvcaaragar
Timeline for d1xsfa1: