Lineage for d1xsfa1 (1xsf A:23-108)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2533617Family d.2.1.8: RPF-like [159824] (2 proteins)
    Pfam PF06737; Transglycosylase-like domain
  6. 2533618Protein Probable resuscitation-promoting factor RpfB [159825] (1 species)
  7. 2533619Species Mycobacterium tuberculosis [TaxId:1773] [159826] (1 PDB entry)
    Uniprot O05594 247-362
  8. 2533620Domain d1xsfa1: 1xsf A:23-108 [145890]

Details for d1xsfa1

PDB Entry: 1xsf (more details)

PDB Description: solution structure of a resuscitation promoting factor domain from mycobacterium tuberculosis
PDB Compounds: (A:) Probable resuscitation-promoting factor rpfB

SCOPe Domain Sequences for d1xsfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsfa1 d.2.1.8 (A:23-108) Probable resuscitation-promoting factor RpfB {Mycobacterium tuberculosis [TaxId: 1773]}
ppvidgsiwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeq
iavaevtrlrqgwgawpvcaaragar

SCOPe Domain Coordinates for d1xsfa1:

Click to download the PDB-style file with coordinates for d1xsfa1.
(The format of our PDB-style files is described here.)

Timeline for d1xsfa1: