Lineage for d1xqra1 (1xqr A:87-350)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1278586Superfamily a.118.1: ARM repeat [48371] (24 families) (S)
  5. 1278992Family a.118.1.21: HspBP1 domain [140822] (1 protein)
    this is a repeat family; one repeat unit is 1xqr A:200-242 found in domain
  6. 1278993Protein Hsp70-binding protein 1 (HspBP1) [140823] (1 species)
  7. 1278994Species Human (Homo sapiens) [TaxId:9606] [140824] (2 PDB entries)
    Uniprot Q9NZL4 87-350
  8. 1278995Domain d1xqra1: 1xqr A:87-350 [122241]

Details for d1xqra1

PDB Entry: 1xqr (more details), 2.1 Å

PDB Description: crystal structure of the hspbp1 core domain
PDB Compounds: (A:) HSPBP1 protein

SCOPe Domain Sequences for d1xqra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}
rgeveqmksclrvlsqpmpptageaeqaadqqeregalelladlcenmdnaadfcqlsgm
hllvgryleagaaglrwraaqligtcsqnvaaiqeqvlglgalrkllrlldrdacdtvrv
kalfaisclvreqeagllqflrldgfsvlmramqqqvqklkvksafllqnllvghpehkg
tlcsmgmvqqlvalvrtehspfhehvlgalcslvtdfpqgvrecrepelgleellrhrcq
llqqheeyqeelefcekllqtcfs

SCOPe Domain Coordinates for d1xqra1:

Click to download the PDB-style file with coordinates for d1xqra1.
(The format of our PDB-style files is described here.)

Timeline for d1xqra1: