Lineage for d1xqra1 (1xqr A:84-350)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. Family a.118.1.21: HspBP1 domain [140822] (1 protein)
    this is a repeat family; one repeat unit is 1xqr A:200-242 found in domain
  6. Protein Hsp70-binding protein 1 (HspBP1) [140823] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [140824] (2 PDB entries)
    Uniprot Q9NZL4 87-350
  8. Domain d1xqra1: 1xqr A:84-350 [122241]
    Other proteins in same PDB: d1xqra2, d1xqrb3

Details for d1xqra1

PDB Entry: 1xqr (more details), 2.1 Å

PDB Description: Crystal structure of the HspBP1 core domain
PDB Compounds: (A:) HSPBP1 protein

SCOPe Domain Sequences for d1xqra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xqra1 a.118.1.21 (A:84-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}
rgqrgeveqmksclrvlsqpmpptageaeqaadqqeregalelladlcenmdnaadfcql
sgmhllvgryleagaaglrwraaqligtcsqnvaaiqeqvlglgalrkllrlldrdacdt
vrvkalfaisclvreqeagllqflrldgfsvlmramqqqvqklkvksafllqnllvghpe
hkgtlcsmgmvqqlvalvrtehspfhehvlgalcslvtdfpqgvrecrepelgleellrh
rcqllqqheeyqeelefcekllqtcfs

SCOPe Domain Coordinates for d1xqra1 are not available.

Timeline for d1xqra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xqra2
View in 3D
Domains from other chains:
(mouse over for more information)
d1xqrb2, d1xqrb3