Lineage for d1xq9a_ (1xq9 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the restSuperfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) 
Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) Protein Phosphoglycerate mutase [53256] (6 species) 
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [117668] (1 PDB entry)
Uniprot Q8IIG6
Domain d1xq9a_: 1xq9 A: [115835]
Structural genomics target
complexed with scn
Details for d1xq9a_
PDB Entry: 1xq9 (more details), 2.58 Å
PDB Description: structure of phosphoglycerate mutase from plasmodium falciparum at 2.6 resolution
PDB Compounds: (A:) phosphoglycerate mutaseSCOPe Domain Sequences for d1xq9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mttytlvllrhgestwnkenkftgwtdvplsekgeeeaiaagkylkeknfkfdvvytsvl
kraictawnvlktadllhvpvvktwrlnerhygslqglnksetakkygeeqvkiwrrsyd
ipppkldkednrwpghnvvyknvpkdalpfteclkdtvervlpfwfdhiapdilankkvm
vaahgnslrglvkhldnlseadvlelniptgvplvyeldenlkpikhyylldseelkkkm
d
SCOPe Domain Coordinates for d1xq9a_:
Click to download the PDB-style file with coordinates for d1xq9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xq9a_:
- d1xq9a_ first appeared in SCOP 1.71
- d1xq9a_ appears in SCOPe 2.04
- d1xq9a_ is called d1xq9a1 in SCOPe 2.06
- d1xq9a_ appears in the current release, SCOPe 2.08, called d1xq9a1
View in 3D
