SCOP 1.71: Domain d1xq9a_: 1xq9 A:

Lineage for d1xq9a_ (1xq9 A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (3 proteins)

6. Protein Phosphoglycerate mutase [53256] (6 species)

7. Species Plasmodium falciparum [117668] (1 PDB entry)

8. Domain d1xq9a_: 1xq9 A: [115835]

Details for d1xq9a_

PDB Entry: 1xq9, 2.58 Å

PDB Description: structure of phosphoglycerate mutase from plasmodium falciparum at 2.6 resolution

SCOP Domain Sequences for d1xq9a_:

Sequence; same for both SEQRES and ATOM records:

>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum}
mttytlvllrhgestwnkenkftgwtdvplsekgeeeaiaagkylkeknfkfdvvytsvl
kraictawnvlktadllhvpvvktwrlnerhygslqglnksetakkygeeqvkiwrrsyd
ipppkldkednrwpghnvvyknvpkdalpfteclkdtvervlpfwfdhiapdilankkvm
vaahgnslrglvkhldnlseadvlelniptgvplvyeldenlkpikhyylldseelkkkm
d

Timeline for d1xq9a_:

• d1xq9a_ is new in SCOP 1.71
  
• d1xq9a_ appears in SCOP 1.73
  
• d1xq9a_ appears in the current release, SCOPe 2.08, called d1xq9a1