![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily) beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234 |
![]() | Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) ![]() |
![]() | Family d.136.1.4: Polyphosphate kinase C-terminal domain [143860] (1 protein) C-terminal part of Pfam PF02503; similar to PLD; contains two domains of this fold arranged as in the Nuc dimer |
![]() | Protein Polyphosphate kinase, PPK [143861] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [143863] (2 PDB entries) Uniprot P0A7B1 315-501! Uniprot P0A7B1 502-688 |
![]() | Domain d1xdpa3: 1xdp A:315-501 [121898] Other proteins in same PDB: d1xdpa1, d1xdpa2, d1xdpb1, d1xdpb2 automated match to d1xdoa3 complexed with atp, mg |
PDB Entry: 1xdp (more details), 2.5 Å
SCOPe Domain Sequences for d1xdpa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xdpa3 d.136.1.4 (A:315-501) Polyphosphate kinase, PPK {Escherichia coli [TaxId: 562]} plprlrhiwfdkaqfrngfdairerdvllyypyhtfehvlellrqasfdpsvlaikiniy rvakdsriidsmihaahngkkvtvvvelqarfdeeanihwakrlteagvhvifsapglki haklflisrkengevvryahigtgnfnektarlytdyslltadaritnevrrvfnfienp yrpvtfd
Timeline for d1xdpa3:
![]() Domains from other chains: (mouse over for more information) d1xdpb1, d1xdpb2, d1xdpb3, d1xdpb4 |