Lineage for d1xdpa3 (1xdp A:315-501)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584375Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 2584376Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 2584589Family d.136.1.4: Polyphosphate kinase C-terminal domain [143860] (1 protein)
    C-terminal part of Pfam PF02503; similar to PLD; contains two domains of this fold arranged as in the Nuc dimer
  6. 2584590Protein Polyphosphate kinase, PPK [143861] (2 species)
  7. 2584591Species Escherichia coli [TaxId:562] [143863] (2 PDB entries)
    Uniprot P0A7B1 315-501! Uniprot P0A7B1 502-688
  8. 2584592Domain d1xdpa3: 1xdp A:315-501 [121898]
    Other proteins in same PDB: d1xdpa1, d1xdpa2, d1xdpb1, d1xdpb2
    automated match to d1xdoa3
    complexed with atp, mg

Details for d1xdpa3

PDB Entry: 1xdp (more details), 2.5 Å

PDB Description: Crystal Structure of the E.coli Polyphosphate Kinase in complex with AMPPNP
PDB Compounds: (A:) Polyphosphate kinase

SCOPe Domain Sequences for d1xdpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdpa3 d.136.1.4 (A:315-501) Polyphosphate kinase, PPK {Escherichia coli [TaxId: 562]}
plprlrhiwfdkaqfrngfdairerdvllyypyhtfehvlellrqasfdpsvlaikiniy
rvakdsriidsmihaahngkkvtvvvelqarfdeeanihwakrlteagvhvifsapglki
haklflisrkengevvryahigtgnfnektarlytdyslltadaritnevrrvfnfienp
yrpvtfd

SCOPe Domain Coordinates for d1xdpa3:

Click to download the PDB-style file with coordinates for d1xdpa3.
(The format of our PDB-style files is described here.)

Timeline for d1xdpa3: