Lineage for d1x6fa1 (1x6f A:8-82)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892092Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 892093Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families) (S)
  5. 892094Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins)
  6. 892295Protein Zinc finger protein 462, ZNF462 [144137] (1 species)
  7. 892296Species Human (Homo sapiens) [TaxId:9606] [144138] (1 PDB entry)
    Uniprot Q96JM2 719-793
  8. 892297Domain d1x6fa1: 1x6f A:8-82 [121742]
    ZnF 6 flanked with unstructured regions
    complexed with zn

Details for d1x6fa1

PDB Entry: 1x6f (more details)

PDB Description: solution structures of the c2h2 type zinc finger domain of human zinc finger protein 462
PDB Compounds: (A:) Zinc finger protein 462

SCOP Domain Sequences for d1x6fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]}
lkrdfiilgngprlqnstyqckhcdsklqstaeltshlnihneefqkrakrqerrkqlls
kqkyadgafadfkqe

SCOP Domain Coordinates for d1x6fa1:

Click to download the PDB-style file with coordinates for d1x6fa1.
(The format of our PDB-style files is described here.)

Timeline for d1x6fa1: