Lineage for d1x57a1 (1x57 A:8-85)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768343Family a.35.1.12: EDF1-like [140529] (1 protein)
    part of Pfam PF01381
  6. 768344Protein Endothelial differentiation-related factor 1, EDF1 [140530] (1 species)
  7. 768345Species Human (Homo sapiens) [TaxId:9606] [140531] (1 PDB entry)
    Uniprot O60869 71-148
  8. 768346Domain d1x57a1: 1x57 A:8-85 [121704]

Details for d1x57a1

PDB Entry: 1x57 (more details)

PDB Description: solution structures of the hth domain of human edf-1 protein
PDB Compounds: (A:) Endothelial differentiation-related factor 1

SCOP Domain Sequences for d1x57a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]}
drvtlevgkviqqgrqskgltqkdlatkinekpqviadyesgraipnnqvlgkieraigl
klrgkdigkpiekgprak

SCOP Domain Coordinates for d1x57a1:

Click to download the PDB-style file with coordinates for d1x57a1.
(The format of our PDB-style files is described here.)

Timeline for d1x57a1: