Lineage for d1x3ma1 (1x3m A:193-397)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492018Family c.55.1.2: Acetokinase-like [53080] (4 proteins)
  6. 2492053Protein Propionate kinase [142462] (1 species)
  7. 2492054Species Salmonella typhimurium [TaxId:90371] [142463] (12 PDB entries)
    Uniprot O06961 193-397! Uniprot O06961 4-192
  8. 2492057Domain d1x3ma1: 1x3m A:193-397 [121664]
    complexed with adp

Details for d1x3ma1

PDB Entry: 1x3m (more details), 2.2 Å

PDB Description: crystal structure of adp bound propionate kinase (tdcd) from salmonella typhimurium
PDB Compounds: (A:) Propionate kinase

SCOPe Domain Sequences for d1x3ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3ma1 c.55.1.2 (A:193-397) Propionate kinase {Salmonella typhimurium [TaxId: 90371]}
dekdsglivahlgngasicavrngqsvdtsmgmtpleglmmgtrsgdvdfgamawiaket
gqtlsdlervvnkesgllgisglssdlrvlekawhegherarlaiktfvhriarhiagha
aslhrldgiiftggigensvlirqlviehlgvlgltldvemnkqpnshgeriisanpsqv
icaviptneekmialdaihlgnvka

SCOPe Domain Coordinates for d1x3ma1:

Click to download the PDB-style file with coordinates for d1x3ma1.
(The format of our PDB-style files is described here.)

Timeline for d1x3ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x3ma2