Lineage for d1wvka_ (1wvk A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894595Fold g.82: Expressed protein At2g23090/F21P24.15 [118358] (1 superfamily)
    not assigned; partly disordered
  4. 894596Superfamily g.82.1: Expressed protein At2g23090/F21P24.15 [118359] (1 family) (S)
    putative zinc-finger protein
  5. 894597Family g.82.1.1: Expressed protein At2g23090/F21P24.15 [118360] (1 protein)
  6. 894598Protein Expressed protein At2g23090/F21P24.15 [118361] (1 species)
  7. 894599Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118362] (1 PDB entry)
    Uniprot O64818 2-78
  8. 894600Domain d1wvka_: 1wvk A: [114919]
    structural genomics target

Details for d1wvka_

PDB Entry: 1wvk (more details)

PDB Description: nmr solution structure of the partially disordered protein at2g23090 from arabidopsis thaliana
PDB Compounds: (A:) At2g23090/F21P24.15

SCOP Domain Sequences for d1wvka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvka_ g.82.1.1 (A:) Expressed protein At2g23090/F21P24.15 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ghhhhhhlegggnaqksamaraknlekakaagkgsqleankkamsiqckvcmqtfictts
evkcrehaeakhpkadvvacfphlkk

SCOP Domain Coordinates for d1wvka_:

Click to download the PDB-style file with coordinates for d1wvka_.
(The format of our PDB-style files is described here.)

Timeline for d1wvka_: