Lineage for d1wnla2 (1wnl A:1-188)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663707Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1663708Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1663966Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins)
  6. 1663975Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)
  7. 1663976Species Pyrococcus horikoshii [TaxId:53953] [143641] (26 PDB entries)
    Uniprot O57883 1-188
  8. 1663995Domain d1wnla2: 1wnl A:1-188 [121095]
    Other proteins in same PDB: d1wnla1, d1wnlb1
    complexed with adp, gol

Details for d1wnla2

PDB Entry: 1wnl (more details), 1.6 Å

PDB Description: Crystal Structure Of Biotin-(Acetyl-CoA-Carboxylase) ligase From Pyrococcus Horikoshii Ot3 in complex with ADP
PDB Compounds: (A:) biotin--[acetyl-CoA-carboxylase] ligase

SCOPe Domain Sequences for d1wnla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnla2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

SCOPe Domain Coordinates for d1wnla2:

Click to download the PDB-style file with coordinates for d1wnla2.
(The format of our PDB-style files is described here.)

Timeline for d1wnla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wnla1