Lineage for d1wjga_ (1wjg A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 827433Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 827807Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 827975Family c.26.2.4: Universal stress protein-like [52436] (7 proteins)
    Pfam PF00582
  6. 827996Protein Hypothetical protein TTHA0895 [117487] (1 species)
  7. 827997Species Thermus thermophilus [TaxId:274] [117488] (4 PDB entries)
    Uniprot Q5SJV7
  8. 828001Domain d1wjga_: 1wjg A: [114696]
    Structural genomics target

Details for d1wjga_

PDB Entry: 1wjg (more details), 2.1 Å

PDB Description: Crystal structure of a probable ATP binding protein from thermus themophilus HB8
PDB Compounds: (A:) probable ATP binding protein

SCOP Domain Sequences for d1wjga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjga_ c.26.2.4 (A:) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]}
fktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrler
aegvleearaltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsq
sqrvvaeapcpvllv

SCOP Domain Coordinates for d1wjga_:

Click to download the PDB-style file with coordinates for d1wjga_.
(The format of our PDB-style files is described here.)

Timeline for d1wjga_: