Lineage for d1wh1a_ (1wh1 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538457Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1538458Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1538459Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1538541Protein Hypothetical protein KIAA1095 [101723] (1 species)
  7. 1538542Species Human (Homo sapiens) [TaxId:9606] [101724] (2 PDB entries)
    Uniprot Q9UPQ7 246-339, 404-512
  8. 1538544Domain d1wh1a_: 1wh1 A: [114629]
    Structural genomics target; 4th PDZ domain

Details for d1wh1a_

PDB Entry: 1wh1 (more details)

PDB Description: solution structure of the fourth pdz domain of kiaa1095 protein
PDB Compounds: (A:) KIAA1095 protein

SCOPe Domain Sequences for d1wh1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgdihqemdreeleleevdlyrmnsqdklgltvcyrtddeddigiyiseidpnsi
aakdgriregdriiqingievqnreeavalltseenknfslliarpelqldegwmdddsg
pssg

SCOPe Domain Coordinates for d1wh1a_:

Click to download the PDB-style file with coordinates for d1wh1a_.
(The format of our PDB-style files is described here.)

Timeline for d1wh1a_: